H14_HUMAN
Histone H1.4
Peptide Coverage
The plot visualizes all unique peptides sequences that match this protein in form of a position-wise coverage bar plot or multiple sequence alignment (optional when zooming in). All peptide sequences were experimentally identified as HLA-presented peptides in the HLA Ligand Atlas. Additionally, the predicted binder status of each peptide is color coded, whereas a peptide is considered a predicted binder if a binding prediction tool predicted this peptide to be at least a weak binder against any allele of any donor the peptide was found in.
Loading...
Sequence
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAKPKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK